Research use only Not for human or animal use or consumption. Not FDA-approved. Buyers must be 21+ and accept our Terms of Service and Compliance Policy.
Thymic Peptides New
FOXO4-DRI 10mg laboratory research peptide
CAS2460055-10-9
FormulaC228H388N86O64
Mol. weight5358.15 Da
Quantity10mg/vial
Purity99.0% HPLC
IdentityConfirmed
ReportBy email on request
StockIn stock

FOXO4-DRI 10mg

FOXO4 D-retro-inverso peptide, FOXO4-DRI TFA salt, FOXO4 DRI · CAS 2460055-10-9

FOXO4-DRI 10mg from Pepta Labs is one sealed glass vial holding a supplier-stated 10 mg of FOXO4-DRI peptide as lyophilized (freeze-dried) powder, sold for laboratory research only. The 10 mg vial is the only FOXO4-DRI size Pepta Labs lists, and it can be ordered as one vial or several. The independent HPLC purity and mass-spectrometry identity report for the sourced production run is sent by email on request, before you order if you want it: use the request form on this page or email support@peptalabs.com.

FOXO4-DRI 10mg: $119.84 per vial ($11.98 per mg of the supplier-stated 10 mg). Ships to US addresses only. FOXO4-DRI 10mg (FOXO4-DRI Peptide) is a lyophilized research peptide supplied as 10mg of dry powder per sealed vial. CAS 2460055-10-9; molecular formula C228H388N86O64; molecular weight 5358.15 Da. Purity is reported as 99% by reversed-phase HPLC and identity is confirmed by mass spectrometry; the analytical report is available by email. Supplied for laboratory research use only.

99.0% pure Identity confirmed
$119.84
$11.98 per mg
Free US shipping · Most orders ship the next business day
Pack size and price
Quantity

Checkout uses a free account with a confirmed email.

Code FALL25: 25% off at checkout.
Free US shipping, no minimum
Most orders ship the next business day as dry powder at ambient temperature. Unopened products in original sealed condition may be returned within 30 days of delivery with return authorization.
Report by email before you order
Independent HPLC purity and MS identity report on request. Pepta Labs does not test in-house.
Payment methods
Pepta Labs accepts Cash App, Venmo, Zelle, Bitcoin and Ethereum (5% crypto discount). Payment instructions are emailed as soon as you place your order.
Research use only
Not for human or animal use. Certified at checkout from a registered account.
Specifications

FOXO4-DRI 10mg at a glance

FOXO4-DRI 10mg is supplied as lyophilized powder in a sealed glass vial for laboratory research only. It is not for human or animal use, consumption, administration, diagnosis or treatment.

Full name
FOXO4-DRI Peptide
Quantity
10mg/vial
CAS number
2460055-10-9
Molecular formula
C228H388N86O64
Sequence
H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH (chiral residues D-configuration; Gly achiral)
Purity
99.0% by HPLC
Identity
Confirmed by mass spectrometry
Physical form
Lyophilized (freeze-dried) powder, sealed glass vial
Report
Sent by email on request, before you order if you want to see it first.
Not claimed
Sterility, endotoxin or LAL, potency, pharmaceutical-grade, cGMP, contaminant-panel or vial fill-quantity testing
Category
Thymic Peptides
Chemical identity

What FOXO4-DRI is

FOXO4-DRI (FOXO4 D-retro-inverso peptide) is a synthetic linear 46-residue peptide built from D-amino acids in reversed (retro-inverso) order relative to the parent L-sequence, which joins a segment derived from the FOXO4 forkhead box protein to a segment derived from the HIV-1 Tat protein. Its sequence, written N to C, is LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG with the chiral residues in the D-configuration (glycine is achiral). The molecular formula is C228H388N86O64, molecular weight 5358.15 g/mol, CAS Registry Number 2460055-10-9 and PubChem CID 167312269. Ten arginine and four lysine residues give the molecule a high positive charge, so it is normally obtained as a multi-trifluoroacetate or acetate salt. Pepta Labs lists FOXO4-DRI as 10 mg of lyophilized powder per sealed glass vial, with reported RP-HPLC purity (99.0% on the current listing) and identity confirmed by mass spectrometry. Store sealed vials at 2-8 C short term or -20 C long term. For laboratory research use only.

Also known as
FOXO4 D-retro-inverso peptide, FOXO4-DRI TFA salt, FOXO4 DRI
Structural class
synthetic linear 46-residue D-retro-inverso peptide (D-amino acids, reversed sequence), highly cationic
Residues
46 amino acids
Salt form
typically supplied as multi-trifluoroacetate or acetate salt
PubChem CID
167312269
Handling

Storage, form and restrictions

Shipping
Ships at ambient temperature with no cold pack and no insulated packaging. No cold chain is required for dry powder.
Storage
Refrigerate at 2–8°C on arrival, or hold at −20°C for long-term storage. Keep sealed vials away from light and moisture.
Research use only
Offered solely for laboratory research. Not for human or animal use, consumption, administration, diagnosis or treatment. See the research use policy.
Questions

FOXO4-DRI 10mg — common questions

What sizes of FOXO4-DRI are for sale?

Pepta Labs lists FOXO4-DRI in one size: a 10 mg vial of lyophilized powder. There is no smaller or larger FOXO4-DRI vial in the catalog. You can order more than one 10 mg vial of this same listing; the pack options appear in the cost answer on this page.

What is inside a FOXO4-DRI 10mg vial as supplied?

A sealed glass vial containing a supplier-stated 10 mg of FOXO4-DRI as dry lyophilized powder; no diluent or liquid is included. The label identifies the compound, quantity and research-use designation; it does not carry a lot or batch number. Vial fill-quantity testing is not claimed.

Is FOXO4-DRI sold as a TFA or acetate salt?

Catalog data describe FOXO4-DRI as typically supplied as a multi-trifluoroacetate (TFA) or acetate salt, and FOXO4-DRI TFA salt is one of its listed names. A counter-ion is not stated per vial on this listing, so if your work depends on it, say so when you request the report. The Learn guide TFA vs Acetate Peptide Salts explains how the salt form appears on an analytical report.

How do I get the HPLC and mass spec report for FOXO4-DRI?

Request it on this page or email support@peptalabs.com with the compound name, before or after ordering. The report covers the sampled production run Pepta Labs sourced, not an individual vial: purity is given as reversed-phase HPLC area percent and identity is confirmed by mass spectrometry; the catalog molecular weight to compare against is 5358.15 Da. The Learn guide How to Read and Verify a Peptide Certificate of Analysis walks through each field.

How should sealed FOXO4-DRI powder be stored?

Keep the sealed vial of dry powder refrigerated at 2-8 C for short-term storage or at -20 C for long-term storage, away from light and moisture. It ships as dry powder at ambient temperature with no cold pack. The Learn guide Storage Temperature and Handling of Lyophilized Research Peptides covers temperature and moisture in more detail.

Where can I buy FOXO4-DRI in the US?

Pepta Labs sells FOXO4-DRI 10mg online and ships to US addresses only, with free US shipping. The compound also appears under the names FOXO4 DRI and FOXO4 D-retro-inverso peptide; both refer to CAS 2460055-10-9. Orders are placed from a free account with a confirmed email and a research-use certification, and buyers must be 21 or older.

What does FOXO4-DRI 10mg cost?

FOXO4-DRI 10mg starts at $119.84 per vial. 3-vial packs are 10% off and 5-vial packs are 15% off. US shipping is free with no minimum.

What payment methods are accepted?

Pepta Labs accepts Cash App, Venmo, Zelle, Bitcoin and Ethereum (5% crypto discount). Payment instructions are emailed as soon as you place your order.

Is this for human or animal use?

No. FOXO4-DRI 10mg is offered solely for laboratory research and is not for human or animal use, consumption, administration, diagnosis or treatment. Buyers certify this at checkout.

What does D-retro-inverso (DRI) mean in FOXO4-DRI?

The peptide is synthesized from D-amino acids (mirror images of the natural L-amino acids) and the residue order is reversed relative to the parent sequence. Because the atoms are the same, the formula C228H388N86O64 and mass 5358 g/mol are identical to the L-form; only stereochemistry and direction differ, and chiral chromatography or the CAS number 2460055-10-9 distinguish them.

Why is the gross powder weight of FOXO4-DRI higher than its peptide content?

With ten arginine and four lysine residues the peptide carries many positive charges, each balanced by a counter-ion (trifluoroacetate or acetate). Those counter-ions plus bound water add to the gross weight, so the peptide content is lower than the weight of powder in the vial. Net peptide content and vial fill quantity are not claimed.

What does the CAS number 2460055-10-9 identify?

It is the CAS Registry Number assigned to the specific 46-residue D-retro-inverso sequence of FOXO4-DRI, distinguishing it from the corresponding L-amino-acid peptide and from other FOXO4-derived sequences.

FOXO4-DRI 10mg
$119.84